ELF 44 (444$r$r   /libexec/ld-elf.so.1FreeBSD0 CGC2>7 43@;"8*&9D  %1#A)!FB<E:,  +'- /0=.($56?`4L3  ?%.@Z<_E%MYj~ d ZX"drT  @82k)sq#[!L E(I:CSj}"Ie>0E8+}Q@ 0Dlibssl.so.5SSL_set_fdSSL_shutdown_DYNAMICSSL_get_errorSSL_readSSL_newSSL_CTX_newSSL_library_initTLSv1_client_methodSSL_CTX_set_verifySSL_load_error_strings_finiSSL_ctrl_GLOBAL_OFFSET_TABLE_SSL_connectSSL_get_peer_certificate_Jv_RegisterClassesSSL_writelibc.so.7__mb_sb_limitmemmove__srget__inet_addrgetc__stderrpmallocvsnprintfsocketstrtol_DefaultRuneLocalestrrchrcallocstrtodenvironfprintf__prognamestrstr__errorstrncmprealloc_CurrentRuneLocalesscanfstrdupfopen__isthreadedmemset_init_tls__swbuffclosestrcmpsprintfatexitfputcfwriteatoistrlenstrchrfputsfree_edata__bss_start_endFBSD_1.0(z!,1;       "#$% &$'((,*0+4-8.<0@2D3H4L5P6T:X<\=`>d?h@lApBtDxE|F h3H 5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP% h@%h0%h %h%h% h%$h%(h%,h%0h%4h %8h(%<h0%@h8p%Dh@`%HhHP%LhP@%PhX0%Th` %Xhh%\hp%`hx%dh%hh%lh%ph%th%xh%|hUVS]эt ۉ5~6Et/t# t/uu츴t4 $$LEt$D$$w$͐U=t ҡuÐUtt $ÐL$qUSQ 8tUDž$ D$D$$E؋ B A$ CD$$ t9D$ D$9D$$ Dž$B B$OE A[ Dž$ C$Z BD$$I t0 A$$d fE}xRD$ D$D$$ Dž$M Dž$9 D$ D$D$$Dž$ EED$D$E؉$y4D$ D$D$$qDž$hEE$Eă}u?D$ D$D$$'E؉$Dž$JD$D$Eĉ$Eĉ$GEȃ}u?D$ D$D$$;E؉$^Dž$E؉D$Eȉ$]u?D$ D$D$$KTE؉$ Dž$D$ D$D$!Eȉ$7Eȉ$D$Eȉ$ t4D$ D$D$$^Dž$Eȉ$ju*D$ D$D$$x C Z B $ ; A D$:$9 C ,D$$MD$D$,$,$‹ A C,D$T$,D$L$\$ D$@D$$Y$;D$D$Eȉ$bD$D$$D$D$Eȉ$wE܃}t;cD$ D$CD$$Dž$0D$ D$D$$8EƄ$`vGD$D$Q$t%D$D$d$ D$$E}u%D$D$$=D$ E$E}u%D$D$$(D$D$E$t%D$D$$=D$$E}u%D$D$$qE$‹(9w (=@v%D$D$$(( $8E}u*D$ D$6D$$<( D$D$E$(ED$ D$sT$E$?E$$E@EE(;Ew*D$ D$D$$$LEED$D$Eȉ$RE܃}uD$*ED$$E}u*D$ D$D$$ BD$$}E}u- AD$D$$ ED$ D$D$$4D$D$D$ D$ED$E$4EEE@E@E@@E@@D$D$E$MaE@EEu~E_$ t t tWWRh9M,P(=wCCt9 C]$=w эe[^_]UWVSLE}UMEM~]x;}D4u#u=;}tGtFRRPh+QQuuUu;ttFRPEPh}#u"}xu WjjESj jEP1 EP0/ytFQPEPh*. t) t$ ttFRPSh8*e[^_]UWVSà E D 9r]~UPPE0Qku& 7UY[2hK*+ @ڃ?ʀPf( ?ȀB؃?ȀBB4 ?ȀB?ȀB؃?ȀBB1e[^_]UWVS\UMEo) j@EEu hU)| }E@EEEt}u E uUEEEEE /u E;EveuEU9vz-t z-uz-tF EP؍UJ uSSEPuUu h{QQuu!u&}tUBRRPh$} PujPPhrSu@>uuPjhFPtF EP؍Uv}SSEPuUu hQQuu u}tUBRRPh} tPujSU $K" }]uE;Evx?tF EP؍UuPPEPuUu hPPuu }tUBWWPh-ta&u" UuEM ٍEPU(VVEPuU뚋EQQuu`u}tUBRRPhg} tPujSU $ }u]}r}]etFuE} X tWujPU ^u }tu] SU]QQSuOu}tUBRRPh j@Eu h j@E@Eu u$E@/) /t?u'PPEPuU>PwVh>EE@"EtX'M&u! UuMz EP؍U؍M9PPEPuUuzIuo=tj/te>t`?t[&u! UuME EP؍U؍M&PPURuUuEVVuWe tSSEPuUÃXuۃ=DQQURuU*lu݃'t"upE܉EM9&u! UuMb EPU؍M,CRREPuUuE܈E܍]@E^ui=td/t_>tZ&u! UuM ٍEPUPPURuUuEPuuW /t?uCPwuhkPPEPuU>t6PwVh>>tPPURuU u0Xu'uS u^u/u0SSEPuU>tQuPhM<$} t RujWU }u}/t}}t> WU}E,} t&PujWU <$Gu 19}!EEEd&u- UuEME P }t}t uE PMUu{PPURuUK uUuEEqB ;Ett9Ut\UB tPPERphXuX uKXu`E hYEe[^_]U uuMU EhxUS]MEU ]]E] []U E uuMEhܻU MU EjjhxyUEU ME EE]PU E MjjhܻEUWVS }=u GHGy W#@ WnÃU dlx)_ V M DuQ=u GHGy W@ WƒE uQ=u GHGy W6@ WƒU %=u|=u GHGy W@ W"ƒ<%,? ӃWWShs%==u GHGy WI0@ Wƃ%=u GHGy W@ WDƒ^%N? މ? $T%= =u#GHGy We@U WE}E%=u GHGy W0@ WZƃt%d=u GHGy W@ W ƒ$%e?? ]e? u =u GHGy WC@ Wƒ Ӄ t t (==u#GHGy W0@ W&ƃ=u GHGy W W=u#GHGy Wh@ Wƒ Ӄ t t t VVSh9(==u GHGy W0@ WBƃ=u#GHGy W@ W $=w ڍe[^_]UVSÍp u9V8#t L8u%Ph V3y|t C1se[^]UWVS uF;FrF} PVك9x)   ;u3;VrF@FE Wu4;VriF@FWU %=uZ;Vr'F@F% ? ӃPPShs"%=;Vr:F8PV%;Vr F@F%q??  ӁYD%=/;VrFPV%M;VrgF8PV%;Vr7F@F%?e?? ]  Ӂw;VrbFHN Ӄ t t (=+;NrF8@;FFruF@F э$= ٍ;Vr VBV à t t t PPSh9(=wg;Vr xTF8@;FFr x:F@F $=w ڍe[^_]UWVS EY PKt.QQWj&փyARRWPփx1CuPPWj; UPPWPփxEUu1e[^_]UWVSà <"t<'RRVP׃]EZ Pt.QQVj&׃ypRRVP׃x`CuPPVj; USSVBP׃x>EUBt:EuEQQVP׃y RRVP׃x Cu1e[^_]UWVS<]:$Qu SjXZVjU Su @Pj Yuu P_vBU x1Ru эD PjxBU @BWWVj U SSVj/U vQQVj>U cRu Pj\ytuLtHtDQQEPRE0uPvWht S2e[^_]UWVS ]} Et;;u6t21t PɺƉtue[^_]ּe[^_]UWVS }tkE8uc} t]Xp Q>[PPu Wٻu7 W艼Xv耼~WPFPVEHe[^_]UHU&t*"uu C 1O]UWV1S 97ЙQQ4uu R}މ)HRR4uu "PP4u̺ue[^_]UWVS1ۃ } WTy C;^|e[^_]UVuS1P+;tu$J9ӉP}!)ڍVRH PQ衺C9|эe[^]UOHƒcEBD1 hR4ÐUSt1Ћu[]Ð ̻ $FreeBSD: src/lib/csu/i386-elf/crti.S,v 1.7.20.1 2009/04/15 03:14:26 kensmith Exp $Host must be in numeric IP address form eg: 10.20.30.40 port should be a number! create socket failed connect failed SSL_CTX_new failed SSL_new failed SSL_set_fd failed SSL connection failed get server certificate failed! select numplan.dnorpattern, numplan.description, typepatternusage.name as type from numplan, typepatternusage where numplan.tkpatternusage=typepatternusage.enum POST /axl/ HTTP/1.1 Host: %s:%s Accept: text/* Authorization: Basic %s Content-type: text/xml SOAPAction: "CUCM:DB ver=6.0" Content-length: %d Connection: close %s username and password are in wrong format, should be: "user:pass" unable to read ssl data HTTP/1.1 200 OKprotocol error (http code not 200 OK) %s Content-Length: no content length specified %s %d wrong content length specified (1) %s protocol error (header end) %s wrong content length specified (2) %s unable to allocte memory for specified content length %smore data than buffer size unable to parse xml wunable to open %s Number,Description,Type dnorpattern%s,cucm2csv - Cisco Unified Communications Manager - Dial Plan Export Utilityversion 1.0, Copyright (c) 2009 by Antoni Sawicki This utility dumps all Directory Numbers with descriptions into a CSV fileCan be used for CDR log analysis or integration with LDAP/Active Directory Usage: cucm2csv Example: cucm2csv 10.1.2.3 8443 axluser:axlpass numplan.csv AXL Username is created under User Management -> Application UserThe user has to have "Standard AXL API Access" right enabledBad control character 0x%02x not allowed by XML standard!Invalid UTF-8 sequence for character 0x%04x!nullEntity name too long under parent <%s>!Character entity "%s" not terminated under parent <%s>!Entity name "%s;" not supported under parent <%s>!Bad control character 0x%02x under parent <%s> not allowed by XML standard!Unable to expand string buffer to %d bytes!Unable to allocate string buffer!Bad custom value '%s' in parent <%s>!integerrealBad %s value '%s' in parent <%s>!Unable to add value node of type %s to parent <%s>!Bare < in element!!--![CDATA[Early EOF in comment node!Unable to add comment node to parent <%s>!Early EOF in CDATA node!Unable to add CDATA node to parent <%s>!Early EOF in processing instruction node!Unable to add processing instruction node to parent <%s>!Unable to add declaration node to parent <%s>!(null)Mismatched close tag <%s> under parent <%s>!Unable to add element node to parent <%s>!Unable to allocate memory for name!Unable to allocate memory for value!Expected '>' after '%c' for element %s, but got '%c'!Bare < in element %s!Missing value for attribute '%s' in element %s!Expected > but got '%c' instead for element <%s/>!Missing close tag under parent <%s>!Early EOF in declaration node!%d%fMXML_ELEMENTMXML_INTEGERMXML_OPAQUEMXML_REALMXML_TEXTMXML_CUSTOMܧl=JWcmw1.0?xml version="%s" encoding="utf-8"?![CDATA[%s]]mxml: %s Unable to allocate memory for attribute '%s' in element %s!quotampltgtUnable to add entity callback!AEligAacuteAcircAgraveAlphaAringAtildeAumlBetaCcedilChiDaggerDeltaDstrokETHEacuteEcircEgraveEpsilonEtaEumlGammaIacuteIcircIgraveIotaIumlKappaLambdaMuNtildeNuOEligOacuteOcircOgraveOmegaOmicronOslashOtildeOumlPhiPiPrimePsiRhoScaronSigmaTHORNTauThetaUacuteUcircUgraveUpsilonUumlXiYacuteYumlZetaaacuteacircaeligagravealefsymalphaandaposaringasympatildeaumlbdquobetabrkbarbrvbarbullcapccedilcentchiclubscongcopycrarrcupcurrendArrdaggerdarrdegdeltadiamsdiedivideeacuteecircegraveemptyemspenspepsilonequivetheumleuroexistfnofforallfrac12frac14frac34fraslgammahArrharrheartshelliphibariacuteicirciexcligraveimageinfinintiotaiquestisiniumlkappalArrlambdalanglaquolarrlceilldquolelfloorlowastlozlrmlsaquolsquomacrmdashmicromiddotminusmunablanbspndashninotnotinnsubntildenuoacuteocircoeligograveolineomegaomicronoplusordfordmoslashotildeotimesoumlparapartpermilperpphipipivplusmnpoundprimeprodproppsirArrradicrangraquorceilrdquoregrfloorrhorlmrsaquorsquosbquoscaronsdotsectshysigmasigmafsimspadessubesumsupsup1sup2sup3supeszligtauthere4thetathetasymthinspthorntradeuArruacuteuarrucircugraveupsihupsilonuumlweierpxiyacuteyenyumlzetazwjzwnjqw~!  !$+.R4;AHNV]dimp3 vz~`xx5!H&'"| "'H"  $+2" 7)";BGKc&QE"V[!a*"el!q x!}f&"  a" ""D Fe"O> !!e&& #)06<C!I"O+"SX_"dio!t{)#!# d" #"% 9  L< "" (`" " "" S%> +19"("?DIPW"^ch"m0 t"y}2 ""C"!"*#\! # ! # :   a"<"`&"""#"',16";AE4"LR[ bXh"!n!sz!!  $FreeBSD: src/lib/csu/i386-elf/crtn.S,v 1.6.20.1 2009/04/15 03:14:26 kensmith Exp $H  L$ćT  ((oooP *:JZjzʍڍ *:JZjzʎڎ *:JZjzʏڏ *:JZj$FreeBSD: src/lib/csu/common/crtbrand.c,v 1.4.20.1.6.1 2009/04/15 03:14:26 kensmith Exp $$FreeBSD: src/lib/csu/i386-elf/crt1.c,v 1.15.8.1 2009/04/15 03:14:26 kensmith Exp $GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD]GCC: (GNU) 4.2.1 20070719 [FreeBSD].shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.jcr.got.bss.comment   !$$0' TTp/ć7oPP Do S  (\ ((  e ` kDqLLU wXXUp PЅ